Analytical Data
-
Gene name
alaC
- Application
-
Alternative Names
alaC；yfdZ；Glutamate-pyruvate aminotransferase AlaC
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P77434
-
Expression Region
1-412aa
-
AA Sequence
MADTRPERRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGNPDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISRWYQDRYDVEIDPESEAIVTIGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELERAIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWKAPSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNKTLVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEAGWMVEMPKASMYVWAKIPEPYAAMGSLEFAKKLLNEAKVCVSPGIGFGDYGDTHVRFALIENRDRIRQAIRGIKAMFRADGLLPASSKHIHENAE
-
Molecular Weight
62.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AlaC is a pivotal protein in various biological processes, particularly in the regulation of amino acid metabolism and cellular signaling. Its significance has garnered attention in the fields of microbiology and biochemistry due to its role in the biosynthesis of amino acids and its potential implications in metabolic engineering. Research on AlaC often focuses on its structure-function relationship, revealing the intricate mechanisms by which it interacts with substrates and regulates metabolic pathways. The recombinant expression of AlaC provides invaluable insights into its functionality, facilitating detailed studies on enzyme kinetics, inhibition, and substrate specificity. Additionally, understanding AlaC’s role in different organisms can illuminate evolutionary adaptations and regulatory mechanisms at play in diverse environments. The application of recombinant AlaC in synthetic biology and biotechnology holds promise for the development of novel metabolic pathways, which could enhance the production of valuable biomolecules. As researchers continue to explore AlaC’s structure and function, the protein stands as a vital target for biotechnological innovations and therapeutic interventions, making it an essential subject of study in contemporary biochemical research.
