Cat: PA2000-6137

Recombinant Human C1orf64 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C1orf64

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SRARP; C1orf64; ERRF; SSPR; Steroid receptor-associated and regulated Protein; ER-related factor; Steroid receptor-regulated Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NEQ6

  • Expression Region

    1-169aa

  • AA Sequence

    MAPSEDPRDWRANLKGTIRETGLETSSGGKLAGHQKTVPTAHLTFVIDCTHGKQLSLAATASPPQAPSPNRGLVTPPMKTYIVFCGENWPHLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQAD

  • Molecular Weight

    44.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C1orf64, also known as Chromosome 1 Open Reading Frame 64, has emerged as an intriguing subject of study in molecular biology due to its potential role in various cellular processes and diseases. This gene, located on chromosome 1, encodes a protein whose precise function remains largely undefined, but preliminary research suggests it may be involved in cellular signaling pathways and protein interactions that could influence cell proliferation and apoptosis. Initial studies have indicated that C1orf64 may have implications in cancer, neurodegenerative diseases, and other pathological conditions, raising the question of whether it could serve as a potential biomarker or therapeutic target. Recombination and expression of C1orf64 in model organisms and cell lines can elucidate its biological role and help in understanding the molecular mechanisms underlying its involvement in disease. Furthermore, generating a recombinant protein forms the basis for various biochemical assays that can assess protein function, interaction partners, and regulatory mechanisms. Investigating C1orf64's structure and function through recombinant technology may facilitate the development of novel diagnostic and therapeutic approaches, highlighting its significance in both basic research and clinical applications. As such, ongoing research into C1orf64 not only aims to uncover its biological importance but also to explore its potential as a target for innovative treatments in various diseases, emphasizing the need for continued investigation in this nascent field of study.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US