Analytical Data
-
Gene name
C1orf63
- Application
-
Alternative Names
RSRP1; C1orf63; HT033; NPD014Arginine/serine-rich Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BUV0
-
Expression Region
1-290aa
-
AA Sequence
MSNYVNDMWPGSPQEKDSPSTSRSGGSSRLSSRSRSRSFSRSSRSHSRVSSRFSSRSRRSKSRSRSRRRHQRKYRRYSRSYSRSRSRSRSRRYRERRYGFTRRYYRSPSRYRSRSRSRSRSRGRSYCGRAYAIARGQRYYGFGRTVYPEEHSRWRDRSRTRSRSRTPFRLSEKDRMELLEIAKTNAAKALGTTNIDLPASLRTVPSAKETSRGIGVSSNGAKPELSEKVTEDGTRNPNGKPTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQKKSPYGLWIPI
-
Molecular Weight
59.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf63, also known as chromosome 1 open reading frame 63, is a relatively unexplored protein that has attracted attention due to its potential roles in various biological processes and disease mechanisms. Research into C1orf63 has been motivated by its linkage to several conditions, including certain cancers and genetic disorders. Understanding the structure and function of C1orf63 is critical, as it may play a pivotal role in cellular signaling pathways, cellular growth, and response to stress. The protein's exact function remains elusive, partly due to the lack of comprehensive studies detailing its interactions and regulatory mechanisms. Recent advances in recombinant protein technology have facilitated the production and purification of C1orf63, enabling researchers to investigate its biochemical properties and potential interactions with other cellular components. The study of C1orf63 could pave the way for identifying new therapeutic targets, as its involvement in pathophysiological conditions becomes clearer. Furthermore, exploring the protein's evolutionary conservation may provide insights into its fundamental biological roles and significance across different organisms. As such, C1orf63 represents an intriguing subject for further molecular characterization, and it holds the promise of contributing valuable knowledge to the fields of molecular biology and medicine, particularly in understanding its implications in health and disease.
