Analytical Data
-
Gene name
mnp2c
- Application
-
Alternative Names
mnp2c；Peroxidase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
B5U994
-
Expression Region
21-377aa
-
AA Sequence
APAAQNARCSDGTVVPNSICCDFIPLAQDLTETLFENQCGETAHEVLRLSFHDAIAISQSLGPSAGGGADGSMLIFPDVEPNFAANLGISDSVNDLAPFLASGKFPTITAGDMIQFGAAVAVGLCPGAPQLEFRAGRPNATAPAVDGLIPEPQNTVDEILARFQDAANMNAEDIVSLLVSHTVARADHVDPTLDAAPFDSTPFTFDSQFFLETLLTGVGFPGTTNNTGEVSSPLPLTVGDNVGELRLQSDFELARDSRTACFWQSMINQEALMASRFKAAMAKMAVIGHNANDLIDCSAVVPKPVPALNKPATFPATKTKADVQQACPEPFPNLTTDRAPRETEIPHCPDNEATCTS
-
Molecular Weight
42.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The Mnp2c protein, a member of the Mnp family, has garnered attention in recent years due to its potential applications in biotechnology and medicine. Historically, members of this protein family have been implicated in various biological processes, including cellular signaling, metabolism, and stress response. Research has indicated that Mnp2c plays a critical role in the regulation of enzymatic activities and protein-protein interactions, which are vital for maintaining cellular homeostasis. Additionally, its unique structural characteristics suggest that it may possess specific functional properties that can be harnessed for industrial applications, such as biocatalysis and biosensing. Advances in recombinant DNA technology have facilitated the production of Mnp2c as a fusion protein, enabling researchers to study its functional dynamics in greater detail. Furthermore, the exploration of Mnp2c as a therapeutic target has opened new avenues for drug development, particularly in diseases where its expression is altered. Overall, understanding the biochemical and functional properties of Mnp2c through recombinant protein studies is essential for elucidating its roles in health and disease, making it a significant focus of contemporary research in molecular biology and biotechnology.
