Cat: PA2000-2280

Recombinant Human ZNF160 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZNF160

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZNF160;KIAA1611;Zinc finger Protein 160

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9HCG1

  • Expression Region

    1-147aa

  • AA Sequence

    MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF

  • Molecular Weight

    22.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZNF160, a member of the zinc finger protein family, has garnered significant attention in molecular biology and genetics due to its potential roles in transcriptional regulation, cellular differentiation, and development. Research has shown that zinc finger proteins are critical in mediating protein-DNA interactions, thereby influencing gene expression and cellular function. ZNF160 is particularly interesting because it contains multiple zinc finger motifs, suggesting a complex regulatory role in various biological processes. Recent studies have indicated its involvement in pathways related to cell growth and survival, as well as its potential implications in diseases such as cancer. The recombinant expression of ZNF160 allows for detailed functional analysis of this protein, enabling researchers to dissect its role in specific cellular contexts. By producing ZNF160 in heterologous systems, such as bacterial or yeast models, scientists can purify the protein and perform biochemical assays to determine its DNA-binding properties, interactome, and downstream effects. Understanding the mechanisms by which ZNF160 operates could provide insights into its potential applications in therapeutic strategies, particularly in targeting aberrant gene expression in diseases. Thus, the study of ZNF160 recombinant protein not only enhances our understanding of zinc finger proteins' biological functions but also opens avenues for developing novel diagnostic and therapeutic approaches in regenerative medicine and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US