Analytical Data
-
Gene name
ZNF160
- Application
-
Alternative Names
ZNF160；KIAA1611；Zinc finger Protein 160
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HCG1
-
Expression Region
1-147aa
-
AA Sequence
MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF
-
Molecular Weight
22.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF160, a member of the zinc finger protein family, has garnered significant attention in molecular biology and genetics due to its potential roles in transcriptional regulation, cellular differentiation, and development. Research has shown that zinc finger proteins are critical in mediating protein-DNA interactions, thereby influencing gene expression and cellular function. ZNF160 is particularly interesting because it contains multiple zinc finger motifs, suggesting a complex regulatory role in various biological processes. Recent studies have indicated its involvement in pathways related to cell growth and survival, as well as its potential implications in diseases such as cancer. The recombinant expression of ZNF160 allows for detailed functional analysis of this protein, enabling researchers to dissect its role in specific cellular contexts. By producing ZNF160 in heterologous systems, such as bacterial or yeast models, scientists can purify the protein and perform biochemical assays to determine its DNA-binding properties, interactome, and downstream effects. Understanding the mechanisms by which ZNF160 operates could provide insights into its potential applications in therapeutic strategies, particularly in targeting aberrant gene expression in diseases. Thus, the study of ZNF160 recombinant protein not only enhances our understanding of zinc finger proteins' biological functions but also opens avenues for developing novel diagnostic and therapeutic approaches in regenerative medicine and oncology.
