Analytical Data
-
Gene name
ZNF155
- Application
-
Alternative Names
ZNF155；Zinc finger Protein 155
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12901
-
Expression Region
1-538aa
-
AA Sequence
MTTFKEAVTFKDVAVVFTEEELGLLDPAQRKLYRDVMLENFRNLLSVGHQPFHQDTCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAKDLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSISDVPIFDLPQQLYSEEKSYTCDECGKSICYISALHVHQRVHVGEKLFMCDVCGKEFSQSSHLQTHQRVHTGEKPFKCEQCGKGFSRRSALNVHRKLHTGEKPYICEACGKAFIHDSQLKEHKRIHTGEKPFKCDICGKTFYFRSRLKSHSMVHTGEKPFRCDTCDKSFHQRSALNRHCMVHTGEKPYRCEQCGKGFIGRLDFYKHQVVHTGEKPYNCKECGKSFRWSSCLLNHQRVHSGEKSFKCEECGKGFYTNSQLSSHQRSHSGEKPYKCEECGKGYVTKFNLDLHQRVHTGERPYNCKECGKNFSRASSILNHKRLHCQKKPFKCEDCGKRLVHRTYRKDQPRDYSGENPSKCEDCGRRYKRRLNLDILLSLFLNDT
-
Molecular Weight
78.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF155, a member of the zinc finger protein family, plays a crucial role in various biological processes, including gene regulation, transcriptional control, and chromatin remodeling. Its function in cellular differentiation and development has garnered significant interest in the scientific community. Recent studies suggest that ZNF155 may be involved in important pathways related to cell cycle regulation and apoptosis, highlighting its potential implications in cancer biology. The production of recombinant ZNF155 protein provides an essential tool for elucidating its structure-function relationships and biochemical properties. Understanding the mechanisms by which ZNF155 operates could unlock new therapeutic avenues for diseases associated with its dysregulation. Furthermore, the generation of high-quality recombinant ZNF155 can facilitate the development of assays for screening small molecules or peptides that may modulate its activity, ultimately contributing to the design of targeted therapies. As the complexity of gene regulation continues to be a focal point in molecular biology, research on ZNF155 and its recombinant form is expected to deepen our understanding of gene expression dynamics and offer insights into novel strategies for overcoming diseases linked to transcriptional dysregulation.
