Analytical Data
-
Gene name
YPEL1
- Application
-
Alternative Names
YPEL1；Protein yippee-like 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60688
-
Expression Region
1-119aa
-
AA Sequence
MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE
-
Molecular Weight
29.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YPEL1 (Yip1 domain family, member 1) is a protein that has garnered significant interest in recent years due to its potential roles in various cellular processes and disease mechanisms. Initially identified as a key player in cell signaling, YPEL1 is known to be involved in the regulation of cell proliferation, apoptosis, and differentiation. Its association with cancer development has drawn attention, as studies have suggested that altered expression of YPEL1 may contribute to tumorigenesis and metastasis. Furthermore, YPEL1's involvement in the immune response and its potential implications in neurodegenerative diseases highlight its importance in maintaining cellular homeostasis. Research has also indicated that YPEL1 may interact with other cellular proteins, influencing a variety of signaling pathways. Given its multi-faceted roles, the recombinant expression of YPEL1 provides a valuable tool for studying its functions in vitro and in vivo, thereby advancing our understanding of its contributions to health and disease. As such, ongoing studies aim to elucidate the precise mechanisms by which YPEL1 exerts its effects, paving the way for potential therapeutic applications targeting this protein in various pathological contexts.
