Analytical Data
-
Gene name
YARS1
- Application
-
Alternative Names
YARS1；YARS；Tyrosine--tRNA ligase. cytoplasmic
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54577
-
Expression Region
2-528aa
-
AA Sequence
GDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS
-
Molecular Weight
86.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YARS1, or tyrosyl-tRNA synthetase 1, is an essential enzyme involved in the protein synthesis mechanism by catalyzing the attachment of the amino acid tyrosine to its corresponding transfer RNA (tRNA). This process is crucial for generating functional proteins within cells. Research on YARS1 has garnered significant attention due to its implications in various biological processes and diseases, including cancer and autoimmune disorders. Abnormalities in YARS1 expression or activity can lead to dysregulation of protein synthesis, contributing to cellular malfunction and disease progression. Additionally, YARS1 has been implicated in the maturation of regulatory RNA molecules and plays a role in innate immunity responses. Understanding the structure and function of YARS1, as well as the mechanisms governing its activity, provides valuable insights for potential therapeutic interventions. Researchers are increasingly focused on investigating the reactivity, specificity, and interaction of YARS1 with other cellular components to uncover its multifaceted roles in health and disease. The development of YARS1 recombinant proteins for experimental purposes has opened avenues for studying its biochemical properties and interactions, and has potential implications for the design of targeted treatments that could modulate its function. Overall, YARS1 represents a significant focal point in the study of aminoacyl-tRNA synthetases and their regulatory roles in cellular physiology and pathology.
