Analytical Data
-
Gene name
CALML5
- Application
-
Alternative Names
CALML5；CLSP；Calmodulin-like Protein 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NZT1
-
Expression Region
2-146aa
-
AA Sequence
AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE
-
Molecular Weight
31.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CALML5, or Calmodulin-like protein 5, is a member of the calmodulin superfamily involved in various cellular processes, particularly calcium signaling and cellular response mechanisms. Its expression is tissue-specific, with notable presence in the testis and brain, suggesting a role in reproductive health and neurobiology. Recent studies have highlighted its involvement in regulating gene expression, modulating protein-protein interactions, and influencing cellular proliferation and differentiation. Given its potential implications in developmental biology and disease pathogenesis, including cancer and neurodegenerative disorders, researchers are focused on understanding the functional dynamics and structural characteristics of CALML5. The development of recombinant CALML5 proteins is crucial for elucidating its mechanistic roles and interactions within cellular pathways. This endeavor not only aids in deciphering the molecular function of CALML5 but also paves the way for potential therapeutic applications, including the design of novel drugs targeting CALML5-related pathways. Consequently, the study of CALML5 recombinant proteins is positioned at the intersection of molecular biology and biotechnology, offering insights into fundamental biological processes and their implications in human health.
