Analytical Data
-
Gene name
TSPAN2
- Application
-
Alternative Names
TSPAN2;Tetraspanin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60636
-
Expression Region
112-188aa
-
AA Sequence
GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL
-
Molecular Weight
8.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TSPAN2 (tetraspanin-2) is a member of the tetraspanin family, characterized by its four transmembrane domains, which play crucial roles in cell signaling, adhesion, and the organization of membrane microdomains. Recent studies have indicated that TSPAN2 is involved in various biological processes, including neuroinflammation, cancer progression, and immune response regulation. Its expression has been linked to several diseases, particularly neurodegenerative disorders, highlighting its potential as a therapeutic target. The research on TSPAN2 recombinant proteins has gained momentum as scientists seek to elucidate its functional mechanisms through structural and biochemical analyses. By producing TSPAN2 as a recombinant protein, researchers aim to investigate its interactions with other membrane proteins and signaling pathways, thereby uncovering its role in cellular processes. Moreover, recombinant TSPAN2 can serve as a valuable tool for developing diagnostic and therapeutic strategies, particularly in conditions where TSPAN2 is dysregulated. As the understanding of TSPAN2's multifaceted role expands, it is expected that insights gained from recombinant protein studies will contribute significantly to the development of novel interventions for diseases linked to TSPAN2 dysfunction.











