Cat: PA2000-2268

Recombinant Human TSPAN2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TSPAN2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TSPAN2;Tetraspanin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60636

  • Expression Region

    112-188aa

  • AA Sequence

    GKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQL

  • Molecular Weight

    8.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TSPAN2 (tetraspanin-2) is a member of the tetraspanin family, characterized by its four transmembrane domains, which play crucial roles in cell signaling, adhesion, and the organization of membrane microdomains. Recent studies have indicated that TSPAN2 is involved in various biological processes, including neuroinflammation, cancer progression, and immune response regulation. Its expression has been linked to several diseases, particularly neurodegenerative disorders, highlighting its potential as a therapeutic target. The research on TSPAN2 recombinant proteins has gained momentum as scientists seek to elucidate its functional mechanisms through structural and biochemical analyses. By producing TSPAN2 as a recombinant protein, researchers aim to investigate its interactions with other membrane proteins and signaling pathways, thereby uncovering its role in cellular processes. Moreover, recombinant TSPAN2 can serve as a valuable tool for developing diagnostic and therapeutic strategies, particularly in conditions where TSPAN2 is dysregulated. As the understanding of TSPAN2's multifaceted role expands, it is expected that insights gained from recombinant protein studies will contribute significantly to the development of novel interventions for diseases linked to TSPAN2 dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US