Cat: PA1000-5432

Recombinant mouse ENO2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ENO2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ENO2;Gamma-enolase

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P17183

  • Expression Region

    1-434aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSIEKIWAREILDSRGNPTVEVDLYTA KGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSRIAPAL ISSGISVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERD LPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAES FRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELV KEAIDKAGYTEKMVIGMDVAASEFYRDGKYDLDFKSPADPSRYITGDQLG ALYQDFVRNYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKR IERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVSHRSGETE DTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHN FRNPSVL

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ENO2, or enolase 2, is a glycolytic enzyme that plays a crucial role in cellular metabolism and energy production. It is primarily expressed in the brain and is considered a neuron-specific enolase, making it a potential biomarker for neurological diseases. Research on ENO2 has gained momentum due to its involvement in various pathological conditions, including neurodegenerative diseases, ischemic brain injury, and cancers. The protein exists in several isoforms, with ENO2 being distinctively associated with neuron function and development. Its overexpression has been linked to tumorigenesis, while its levels can serve as an indicator of neuronal damage, making it a target of intense study in both cancer and neuroscience fields. Additionally, ENO2 is being explored for its potential role in mediating neuronal signaling and plasticity, which are fundamental to cognitive processes. The recombinant production of ENO2 allows for detailed investigation into its structure-function relationships and interactions with other biomolecules, fostering insights that could lead to novel therapeutic strategies. As a versatile research tool, the availability of ENO2 as a recombinant protein supports advances in diagnostic applications and therapeutic interventions, highlighting its significance in both basic research and clinical settings. The ongoing studies aim not only to elucidate the biological functions of ENO2 but also to harness its potential for innovative approaches in treating neurodegenerative disorders and cancers, emphasizing the importance of this enzyme in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US