Analytical Data
-
Gene name
TOMM40
- Application
-
Alternative Names
TOMM40；C19orf1；PEREC1；TOM40；Mitochondrial import receptor subunit TOM40 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O96008
-
Expression Region
1-361aa
-
AA Sequence
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
-
Molecular Weight
64.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TOMM40, or translocase of outer mitochondrial membrane 40 kDa, is a crucial protein involved in mitochondrial function, particularly in the transport and insertion of various polypeptides into the outer mitochondrial membrane. Research has highlighted TOMM40's potential role in neurodegenerative diseases, particularly Alzheimer's disease, due to its association with mitochondrial dysfunction and oxidative stress. Genetic studies have identified variants in the TOMM40 gene that correlate with an individual's risk of developing late-onset Alzheimer's disease. These variants influence the expression and function of the protein, potentially impacting mitochondrial dynamics and bioenergetics. Given the increasing prevalence of neurodegenerative disorders worldwide, understanding the implications of TOMM40 and its isoforms could provide insights into disease mechanisms and open avenues for novel therapeutic strategies. Researchers are focusing on elucidating the structure-function relationship of TOMM40, investigating its interactions with other mitochondrial proteins, and exploring its role in mediating mitochondrial health. Insights gained from these studies could not only enhance the understanding of Alzheimer's pathogenesis but also offer biomarkers for early diagnosis and targets for intervention.
