Analytical Data
-
Gene name
SHISA3
- Application
-
Alternative Names
SHISA3；Protein shisa-3 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0PJX4
-
Expression Region
22-238aa
-
AA Sequence
QQSGEYCHGWVDVQGNYHEGFQCPEDFDTLDATICCGSCALRYCCAAADARLEQGGCTNDRRELEHPGITAQPVYVPFLIVGSIFIAFIILGSVVAIYCCTCLRPKEPSQQPIRFSLRSYQTETLPMILTSTSPRAPSRQSSTATSSSSTGGSIRRFSFARAEPGCLVPSPPPPYTTSHSIHLAQPSGFLVSPQYFAYPLQQEPPLPGKSCPDFSSS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SHISA3 is a member of the SHISA family of proteins, which are known to play crucial roles in cellular signaling and development. Recent studies have highlighted its involvement in various physiological processes, particularly in the regulation of Wnt signaling pathways, which are essential for cell proliferation, differentiation, and embryonic development. Dysregulation of Wnt signaling is implicated in numerous diseases, including cancer, making SHISA3 a protein of significant interest in biomedical research. Furthermore, SHISA3 has been linked to the modulation of neurotransmission, suggesting its potential role in neurological functions and disorders. The investigation of SHISA3 recombinant proteins could provide insights into its structure-function relationship, elucidate its mechanisms of action, and establish its role as a therapeutic target. Understanding the function of SHISA3 at a molecular level may pave the way for novel approaches in the treatment of diseases associated with Wnt signaling dysregulation and possibly other conditions influenced by SHISA family proteins. Thus, research on SHISA3 recombinant proteins is critical for advancing knowledge in developmental biology and therapeutic innovation.
