Analytical Data
-
Gene name
TIMM17B
- Application
-
Alternative Names
TIMM17B；TIM17B；Mitochondrial import inner membrane translocase subunit Tim17-B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60830
-
Expression Region
1-172aa
-
AA Sequence
MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
-
Molecular Weight
45.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIMM17B, a member of the TIM (Translocase of Inner Mitochondrial Membrane) protein family, plays a critical role in the mitochondrial import pathways, particularly in the translocation of proteins across the inner mitochondrial membrane. Mitochondria are vital organelles responsible for energy production and various metabolic processes, and their dysfunction is linked to numerous diseases, including neurodegenerative disorders and metabolic syndromes. Research into TIMM17B is essential to understand the mechanisms underlying mitochondrial protein import and its implications in cellular homeostasis. Additionally, variations in TIMM17B expression and function have been implicated in age-related decline and pathologies, making it a target for potential therapeutic interventions. Understanding the structure and dynamics of TIMM17B could provide insights into the regulation of mitochondrial functions and the development of diseases, offering a pathway to novel treatment strategies aimed at restoring mitochondrial health and functionality in affected tissues.
