Analytical Data
-
Gene name
FGFR3
- Application
-
Alternative Names
FGFR3；JTK4；Fibroblast growth factor receptor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22607
-
Expression Region
23-375aa
-
AA Sequence
ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPT VWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFS VRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTV RFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSD RGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVE FHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELE VLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSV YAG
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast growth factor receptor 3 (FGFR3) is a crucial regulator of bone and cartilage development, playing a significant role in skeletal growth and maintenance. Mutations in the FGFR3 gene are associated with several skeletal dysplasias, most notably achondroplasia, the most common form of dwarfism. Research surrounding FGFR3 has gained considerable attention due to its implications in developmental biology and potential therapeutic targets for related disorders. The understanding of FGFR3's structure and function has been advanced through the study of recombinant FGFR3 proteins. These proteins are produced using recombinant DNA technology, allowing researchers to obtain large quantities of the protein for detailed biochemical and structural analysis. This has facilitated investigations into the signaling pathways activated by FGFR3, how mutations alter its function, and the development of pharmacological agents that can modulate FGFR3 activity. Moreover, recombinant FGFR3 proteins serve as valuable tools in drug discovery and engineering novel therapeutic strategies. By elucidating the molecular mechanisms behind FGFR3-related skeletal disorders, researchers aim to develop effective treatments that can ameliorate the consequences of these genetic mutations and enhance the quality of life for affected individuals. Overall, the study of FGFR3 recombinant proteins is essential for advancing our understanding of skeletal biology and the potential therapeutic avenues to address FGFR3-related conditions.
