Analytical Data
-
Gene name
C18orf32
- Application
-
Alternative Names
C18orf32; Chromosome 18 open reading frame 32; CR032_HUMAN; FLJ23458; Putative NF-kappa-B-activating Protein 200; UPF0729 Protein C18orf32
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TCD1
-
Expression Region
1-76aa
-
AA Sequence
MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKKD
-
Molecular Weight
8.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C18orf32, also known as chromosome 18 open reading frame 32, is a gene that has garnered attention due to its potential implications in human health and disease. Located on chromosome 18, its encoded protein is believed to play a role in various cellular processes, although its specific function remains largely unclear. Recent studies suggest that alterations in C18orf32 expression may be linked to neurodegenerative diseases and certain types of cancer, prompting researchers to investigate the protein's structure and function further. The recombinant expression of C18orf32 allows for detailed analysis of its biochemical properties and interactions within cellular pathways. By producing the protein in a controlled environment, scientists can examine its role in cellular mechanisms, assess its involvement in disease processes, and evaluate its potential as a biomarker or therapeutic target. Furthermore, understanding C18orf32 may provide insights into the molecular underpinnings of diseases associated with its dysregulation. Overall, the research on C18orf32 recombinant protein is essential for unraveling its biological significance and potential applications in clinical diagnostics and treatments.
