Analytical Data
-
Gene name
C17orf55
- Application
-
Alternative Names
Putative uncharacterized Protein encoded by LINC00482
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N8I6
-
Expression Region
1-264aa
-
AA Sequence
MPRSLKRAQLRSLLPRPPAVSHTQPWYRAAHPTTSPTAASRDVHPASGAVPGPWLVEGTAVREGPQLQDAVPQRPTRPSKALWPAQMSAAPAIRLGQMVPGDTRGLWGPQGTLLTWTYRGGQGGRWTRRAEGPREGTFAEQRPHFQSSGAQQESRLAMGPPPLGLGDAAGDGRGQTGQEKGRAEGRQARKSACKCPRKGPNPGPWTRAAAWWGRLEGAKASAKGEQVRDPGGHLWEQGHVSPCARFNQGHSCGSPKVSHTTWVS
-
Molecular Weight
54.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C17orf55, also known as Chromosome 17 Open Reading Frame 55, is a relatively uncharacterized protein that has drawn increasing attention in recent years due to its potential roles in various cellular processes and implications in human health. Located on chromosome 17, C17orf55 is believed to be involved in cellular signaling pathways and may play a role in the regulation of gene expression and protein synthesis. Studies have suggested that alterations or dysregulation of C17orf55 may be associated with certain diseases, including cancers and neurodegenerative disorders. However, the precise biological functions and mechanisms of action of C17orf55 remain largely unknown, highlighting the necessity for further research. Recent advancements in recombinant protein technology have made it feasible to produce C17orf55 in a laboratory setting, allowing researchers to study its structure, function, and interactions with other molecules more effectively. By generating and analyzing the recombinant C17orf55 protein, scientists aim to elucidate its roles in cellular processes, understand how it may contribute to disease pathogenesis, and potentially identify it as a novel therapeutic target. This research is crucial for developing new strategies to combat diseases associated with C17orf55 dysregulation and for advancing our overall understanding of human genetics and molecular biology.
