Cat: PA1000-5297

Recombinant Human ANP32A / PHAP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANP32A / PHAP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ANP32A / PHAP1;

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P39687

  • Expression Region

    1-249aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMEMGRRIHLELRNRTPSDVKELVLDNSRSN EGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGL EVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLND YRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGE EERGQKRKREPEDEGEDDD

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANP32A, also known as PHAP1 (PH domain and Leucine-rich repeat protein 1), is a member of the ANP32 family involved in various cellular processes, including transcription regulation, apoptosis, and the modulation of protein phosphatase 2A (PP2A) activity. Research into ANP32A/PHAP1 has gained considerable attention due to its implications in cell signaling pathways and potential roles in diseases such as cancer and neurodegenerative disorders. Understanding the structure and function of this protein is critical, as it can influence the stability of many cellular proteins and impact overall cellular homeostasis. Recombinant ANP32A/PHAP1 proteins are essential for elucidating their biochemical properties, interaction networks, and mechanisms of action at the molecular level. Advances in recombinant DNA technology have enabled the production of these proteins in sufficient quantities for in vitro studies, facilitating the exploration of their roles in cellular processes. The ability to study ANP32A/PHAP1 in detail may uncover novel therapeutic targets and strategies for diseases where this protein plays a critical role. Thus, ongoing research focuses on optimizing recombinant protein production, characterizing its functional domains, and uncovering its regulatory mechanisms in different biological contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US