Analytical Data
-
Gene name
SLC4A1
- Application
-
Alternative Names
SLC4A1；AE1；DI；EPB3；Band 3 anion transport Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02730
-
Expression Region
1-403aa
-
AA Sequence
MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSP
-
Molecular Weight
65.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC4A1, also known as the anion exchanger 1 (AE1), is a crucial membrane protein primarily found in red blood cells and various other tissues. It plays a vital role in the exchange of bicarbonate ions (HCO3-) and chloride ions (Cl-), thus contributing to acid-base balance and CO2 transport in the body. Mutations in the SLC4A1 gene can lead to several clinical conditions, including hereditary spherocytosis and distal renal tubular acidosis, highlighting its importance in human health. Research into SLC4A1 has gained traction as scientists aim to understand its structure-function relationship, regulatory mechanisms, and the pathophysiological implications of its dysfunction. The production of recombinant SLC4A1 protein enables detailed biochemical and biophysical studies, providing insights into its transport mechanisms and interaction with various inhibitors or activators. Moreover, elucidating the protein's structure can pave the way for developing targeted therapies to mitigate disorders associated with its malfunction. As such, SLC4A1 research is not only significant for basic science but also has profound implications for therapeutic intervention in related diseases.
