Analytical Data
-
Gene name
SEC16A
- Application
-
Alternative Names
SEC16A；KIAA0310；SEC16；SEC16L；Protein transport Protein Sec16A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15027
-
Expression Region
1943-2154aa
-
AA Sequence
AYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSMPKTVQAAPPALPGPPGAPVNMYSRRAAGTRARYVDVLNPSGTQRSEPALAPADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKLSRCSSMSSLSREVSQHFNQAPGDLPAAGGPPSGAMPFYNPAQLAQACATSGSSRLGRIGQRKHLVLN
-
Molecular Weight
26.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SEC16A is a crucial protein implicated in the regulation of secretory processes within the endoplasmic reticulum (ER) and the Golgi apparatus. It plays a significant role in the organization of ER exit sites, which are essential for the efficient transport of proteins to their intended destinations. Mutations or dysregulation of SEC16A have been linked to various developmental disorders and diseases, including intellectual disabilities and congenital disorders of glycosylation. Researchers have been investigating the structure and function of SEC16A to better understand its role in cellular trafficking and protein secretion. Recent studies using advanced imaging techniques and molecular biology methods have provided insights into the dynamic nature of SEC16A interactions with other proteins at the ER membrane, revealing its critical function in maintaining cellular homeostasis. Understanding SEC16A's mechanistic pathways not only sheds light on fundamental cellular processes but also presents potential therapeutic avenues for conditions associated with its malfunction. This ongoing research has significant implications for the fields of cell biology and medicine, particularly in developing targeted strategies for managing SEC16A-related disorders.
