Cat: PA1000-5223

Recombinant Human c-Kit Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    c-Kit

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    c-Kit;SCFR;Mast/stem cell growth factor receptor Kit

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10721-2

  • Expression Region

    26-516aa

  • AA Sequence

    QPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETN ENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLY GKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSV KRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLRE GEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATL TISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIFPMINTTVFV NDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWEDYPKSENESNIRYVS ELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDRLVNGM LQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQ SSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKEQIHPHT

  • Molecular Weight

    82 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

c-Kit, also known as CD117, is a receptor tyrosine kinase encoded by the KIT gene, which plays a crucial role in cell signaling, particularly in hematopoiesis, development of germ cells, and maintenance of the interstitial cells of Cajal in the gastrointestinal tract. Mutations and aberrant activation of c-Kit are implicated in various cancers, including mastocytosis and certain gastrointestinal stromal tumors (GISTs), making it a significant target for therapeutic intervention. The study of c-Kit recombinant proteins has emerged as a pivotal area of research, focusing on their structure, function, and potential as biomarkers or therapeutic targets. Recombinant c-Kit proteins allow for the investigation of its molecular mechanisms and interactions in a controlled setting, facilitating drug development aimed at inhibiting its overactivity. Advances in protein engineering and expression systems have enabled the production of functional c-Kit proteins, paving the way for high-throughput screening of small molecules as potential inhibitors. Moreover, understanding the signaling pathways activated by c-Kit can provide insights into its role in tumorigenesis and resistance to existing therapies, highlighting the importance of c-Kit research in oncology and regenerative medicine. This line of research holds the promise of discovering novel therapeutic strategies that could enhance treatment outcomes for patients with c-Kit-related malignancies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US