Analytical Data
-
Gene name
TNFSF14
- Application
-
Alternative Names
TNFSF14；HVEA；HVEM；Tumor necrosis factor receptor superfamily member 14
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43557
-
Expression Region
74-240aa
-
AA Sequence
DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFL RGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRY PEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDER LVRLRDGTRSYFGAFMV
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFSF14, also known as T cell-activated gene 3 (TCA3) or LIGHT (Lymphotoxin-β, IL-17, and TNF-family member), is a member of the tumor necrosis factor (TNF) superfamily and plays a pivotal role in immune regulation and inflammation. Research into TNFSF14 has gained significant interest due to its involvement in various immune responses and its potential implications in autoimmune diseases, cancer immunotherapy, and viral infections. The protein is primarily expressed by activated T cells and certain other immune cells, facilitating interactions with its receptors, including HVEM (Herpes Virus Entry Mediator) and LTβR (Lymphotoxin-β Receptor), leading to diverse biological activities such as promotion of T cell proliferation, modulation of dendritic cell function, and enhancement of pro-inflammatory cytokine production. Given its dual role in promoting immune responses and its potential contributions to immune-mediated pathologies, researchers are focused on characterizing recombinant TNFSF14 for therapeutic applications. Monoclonal antibodies targeting TNFSF14 or its receptors are being explored in preclinical and clinical settings for their ability to modulate immune responses in diseases like cancer, where immune evasion is a hallmark. Moreover, the study of TNFSF14's structural properties and signaling pathways is essential to unlock its full therapeutic potential, as understanding its interactions with other immune molecules could lead to novel strategies for enhancing anti-tumor immunity or ameliorating autoimmune conditions. Overall, the recombinant expression and functional study of TNFSF14 represent a promising frontier in immunology, providing insights into its complex role in the immune system and potential avenues for innovative therapeutic interventions.
