Cat: PA1000-5209

Recombinant Human CCL4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCL4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCL4;LAG1;MIP1B;SCYA4;C-C motif chemokine 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13236

  • Expression Region

    24-92aa

  • AA Sequence

    APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQV CADPSESWVQEYVYDLELN

  • Molecular Weight

    8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCL4, also known as macrophage inflammatory protein-1 beta (MIP-1β), is a chemokine that plays a critical role in immune responses by attracting and activating various immune cells, particularly monocytes and T cells. Its involvement in numerous physiological and pathological processes, such as inflammation, immune regulation, and viral infections, has made CCL4 a significant focus of research in immunology. Understanding the structure and function of CCL4 is essential for elucidating its role in disease mechanisms, including cancer, autoimmune disorders, and HIV pathogenesis. Researchers have utilized recombinant DNA technology to produce CCL4 in significant quantities, allowing for in-depth studies of its biological activities, receptor binding, and interaction with other cytokines. Additionally, recombinant CCL4 has potential therapeutic applications, such as in enhancing immune responses during vaccinations or in developing immune-modulatory therapies. The ongoing study of CCL4 not only deepens our understanding of immune signaling networks but also offers insights into innovative strategies for treating immune-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US