Analytical Data
-
Gene name
CCL4
- Application
-
Alternative Names
CCL4;LAG1;MIP1B;SCYA4;C-C motif chemokine 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13236
-
Expression Region
24-92aa
-
AA Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQV CADPSESWVQEYVYDLELN
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL4, also known as macrophage inflammatory protein-1 beta (MIP-1β), is a chemokine that plays a critical role in immune responses by attracting and activating various immune cells, particularly monocytes and T cells. Its involvement in numerous physiological and pathological processes, such as inflammation, immune regulation, and viral infections, has made CCL4 a significant focus of research in immunology. Understanding the structure and function of CCL4 is essential for elucidating its role in disease mechanisms, including cancer, autoimmune disorders, and HIV pathogenesis. Researchers have utilized recombinant DNA technology to produce CCL4 in significant quantities, allowing for in-depth studies of its biological activities, receptor binding, and interaction with other cytokines. Additionally, recombinant CCL4 has potential therapeutic applications, such as in enhancing immune responses during vaccinations or in developing immune-modulatory therapies. The ongoing study of CCL4 not only deepens our understanding of immune signaling networks but also offers insights into innovative strategies for treating immune-related diseases.











