Analytical Data
-
Gene name
C16orf68
- Application
-
Alternative Names
Methyltransferase-like Protein 22. EC:2.1.1.-
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BUU2
-
Expression Region
1-205aa
-
AA Sequence
MVQLAPAAAMDEVTFRSDTVLSDVHLYTPNHRHLMVRLNSVGQPVFLSQFKLLWSQDSWTDSGAKGGSHRDVHTKEPPSAETGSTGSPPGSGHGNEGFSLQAGTDTTGQEVAEAQLDEDGDLDVVRRPRAASDSNPAGPLRDKVHPMILAQEEDDVLGEEAQGSPHDIIRIGVAGRPAPGRLHPVPTGPLPRMYSAGARGRHGAR
-
Molecular Weight
48.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C16orf68, also known as the chromosome 16 open reading frame 68, is a gene that has garnered attention due to its potential roles in various biological processes and diseases. Located on chromosome 16, it encodes a protein that is not yet fully characterized, prompting research into its expression patterns, functional significance, and possible implications in human health. Recent studies have suggested that C16orf68 may be involved in cellular processes such as stress response, apoptosis, and immune function, indicating its potential relevance in pathological conditions, including cancer and autoimmune disorders. The increasing availability of genomic and proteomic data has spurred interest in understanding the function and structure of C16orf68, with researchers employing recombinant protein technology to produce and purify the C16orf68 protein for further studies. This approach allows for the detailed analysis of its functional properties and interactions with other biomolecules, paving the way for insights into the mechanisms through which C16orf68 may affect cellular behavior. As research continues, uncovering the biological role of C16orf68 could lead to novel therapeutic strategies and enhance our understanding of the molecular underpinnings of various diseases, highlighting the importance of this relatively uncharacterized protein in biomedical research.
