Analytical Data
-
Gene name
C15orf57
- Application
-
Alternative Names
CCDC32; C15orf57Coiled-coil domain-containing Protein 32
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BV29
-
Expression Region
1-185aa
-
AA Sequence
MKMFESADSTATRSGQDLWAEICSCLPNPEQEDGANNAFSDSFVDSCPEGEGQREVADFAVQPAVKPWAPLQDSEVYLASLEKKLRRIKGLNQEVTSKDMLRTLAQAKKECWDRFLQEKLASEFFVDGLDSDESTLEHFKRWLQPDKVAVSTEEVQYLIPPESQVEKPVAEDEPAAGDKPAAAEQ
-
Molecular Weight
47.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C15orf57, also known as "Chromosome 15 Open Reading Frame 57," is a protein that has garnered interest in recent years due to its potential role in various biological processes and diseases. Research into C15orf57 has revealed its involvement in crucial cellular functions, including cell cycle regulation, apoptosis, and signal transduction pathways. Emerging evidence suggests that abnormalities in the expression or function of C15orf57 may be linked to certain cancers, neurodevelopmental disorders, and other pathologies. Given its functional significance, understanding the molecular mechanisms of C15orf57 is essential for elucidating its contributions to human health and disease. The development of recombinant C15orf57 protein is crucial for advancing research, enabling scientists to investigate its biochemical properties, interactions with other proteins, and its overall role in cellular processes. Characterizing the recombinant protein can provide insights into its functional domains and potential therapeutic applications, paving the way for novel interventions targeting diseases associated with C15orf57 dysregulation. Moreover, as a candidate biomarker, C15orf57 may hold promise for early diagnosis or prognosis in related diseases, underscoring the importance of further studies into its recombinant form. Thus, comprehensive research on C15orf57 not only enhances our understanding of fundamental biological mechanisms but also offers potential translational benefits in clinical settings.
