Analytical Data
-
Gene name
RBMX
- Application
-
Alternative Names
RBMX；HNRPG；RBMXP1；RNA-binding motif Protein. X chromosome
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P38159
-
Expression Region
333-391aa
-
AA Sequence
DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
-
Molecular Weight
33.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RBMX (RNA-binding motif protein 15) is a multifunctional protein encoded by the RBMX gene, known to play critical roles in RNA processing, transcription regulation, and cellular signaling. Its significance emerges from its involvement in various cellular processes, including mRNA splicing, transcriptional regulation, and signal transduction pathways. Over the years, research has highlighted RBMX's association with several diseases, particularly cancer, where its dysregulation can lead to altered gene expression and tumor progression. Additionally, studies have shown that RBMX interacts with various other proteins and RNA molecules, emphasizing its role as a key player in gene expression and cellular homeostasis. The characterization of RBMX, particularly through recombinant protein studies, is essential for understanding its functional mechanisms and potential as a therapeutic target. By generating RBMX as a recombinant protein, researchers can investigate its structural properties, binding affinity with RNA and other proteins, and functional implications in normal and disease states. Such studies hold promise for unraveling the complexities of gene regulation and the molecular underpinnings of diseases associated with RBMX dysfunction. Overall, ongoing research into RBMX and its recombinant forms aims to deepen our understanding of its roles in cellular biology and develop novel approaches for therapeutic intervention.
