Analytical Data
-
Gene name
Pmaip1
- Application
-
Alternative Names
Pmaip1;NOXA;Phorbol-12-myristate-13-acetate-induced Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13794
-
Expression Region
1-136aa
-
AA Sequence
MPGKKARKNAQPSPARAPAGPAGTAGTARDQAGFAIGMQLRFTRGKKLLSSSLSSSPLAL PRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSF LRRCTFHQFEERLHCN
-
Molecular Weight
6.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Pmaip1, also known as NOXA, is a pro-apoptotic protein that plays a crucial role in the regulation of programmed cell death, particularly in response to cellular stress and damage. Research into Pmaip1 has gained attention due to its involvement in cancer biology, where its expression is often downregulated in various tumors, contributing to cancer cell survival and resistance to therapy. Furthermore, Pmaip1 is part of the Bcl-2 family of proteins, which are pivotal in controlling mitochondrial outer membrane permeabilization, a key event in the apoptosis pathway. Studies have shown that the reintroduction or augmentation of Pmaip1 levels can sensitize cancer cells to chemotherapy and radiation, making it a potential target for therapeutic intervention. Furthermore, Pmaip1 is also implicated in the immune response and has been associated with the regulation of T cell homeostasis. As such, understanding the structure and function of Pmaip1, particularly through the development of recombinant protein technologies, holds promise for elucidating its mechanisms of action and exploring its potential as a biomarker or therapeutic target in cancer treatment and immunotherapy. The recombinant expression of Pmaip1 allows for detailed functional assays, structural studies, and the exploration of its interaction with other apoptotic regulators, paving the way for novel strategies in combating cancer and enhancing therapeutic efficacy. Thus, ongoing research efforts focus on harnessing the properties of Pmaip1 to develop innovative therapeutic modalities that can enhance apoptotic signaling in tumor cells, ultimately leading to improved clinical outcomes in cancer therapy.











