Analytical Data
-
Gene name
ORC4
- Application
-
Alternative Names
ORC4;ORC4L;Origin recognition complex subunit 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43929
-
Expression Region
1-436aa
-
AA Sequence
MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPNCPTDVRQWATSSLSWL
-
Molecular Weight
66.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ORC4, one of the key components of the Origin Recognition Complex (ORC), plays a critical role in the initiation of DNA replication in eukaryotic cells. The ORC is composed of six subunits, with ORC4 being essential for the binding of the entire complex to DNA, thereby marking the replication origins. Research into ORC4 has gained significance due to its involvement in regulating DNA replication timing and ensuring genomic stability. Dysregulation or mutation of ORC4 has been implicated in various cancers, highlighting its importance in cell proliferation and the maintenance of cellular integrity. Additionally, understanding ORC4's function can provide insights into the molecular mechanisms of replication-related diseases and developmental disorders. As researchers continue to investigate the structural and functional properties of ORC4, including its interactions with other proteins and its role in chromatin remodeling, the potential for developing targeted therapies to correct replication errors or enhance genome stability is becoming increasingly promising. Moreover, studying ORC4 in different model organisms helps elucidate its evolutionary conservation and diverse functions across species, making it a pivotal focus in cell biology and genetics.











