Analytical Data
-
Gene name
BIN2
- Application
-
Alternative Names
BIN2；BRAP1；Bridging integrator 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBW5
-
Expression Region
1-244aa
-
AA Sequence
MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNF YQQQAEGHKLYKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELK AIVWNNDLLWEDYEEKLADQAVRTMEIYVAQFSEIKERIAKRGRKLVDYD SARHHLEAVQNAKKKDEAKTAKAEEEFNKAQTVFEDLNQELLEELPILYN SRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEKQHSN
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BIN2 (BRASSINOSTEROID INSENSITIVE 2) is a key component of the brassinosteroid signaling pathway, primarily known for its role in plant growth and development. It is a member of the group of proteins that function as negative regulators of brassinosteroid responses. The study of BIN2 is particularly significant due to its involvement in various physiological processes, such as cell elongation, vascular development, and stress response. Researchers have identified that BIN2 interacts with various transcription factors and other signaling proteins, making it a central player in diverse signaling pathways. Understanding the molecular mechanisms behind BIN2 function can provide insights into how plants adapt to environmental stresses and regulate their growth in response to hormonal signals. Moreover, the functional characterization of BIN2 and its signaling interactions can offer potential applications in agricultural biotechnology, particularly in improving crop resilience and yield. Recent studies utilizing recombinant BIN2 proteins have uncovered intricate regulatory networks and have prompted further investigation into the potential for manipulating this pathway in crop improvement strategies. As a result, BIN2 research continues to be a crucial field of study in plant molecular biology, aiming to elucidate the complex signaling mechanisms that govern plant adaptation and development.
