Analytical Data
-
Gene name
PRADC1
- Application
-
Alternative Names
PRADC1；C2orf7；PAP21；Protease-associated domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BSG0
-
Expression Region
22-188aa
-
AA Sequence
HGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPP EACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDN DSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVN VTSIPTFELLQPPWTFWVDHHHHHH
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRADC1, or PRP-Associated Domain Containing 1, is a gene associated with several critical biological processes, including cell growth and differentiation. Recent research has highlighted its potential roles in various diseases, including cancers and neurological disorders. The PRADC1 protein is believed to be involved in the regulation of RNA processing and might play a significant role in the cellular response to stress. Given its involvement in gene regulation and potential impact on disease mechanisms, recombinant PRADC1 proteins are being investigated for their functional roles in cellular pathways. The production of PRADC1 as a recombinant protein allows researchers to explore its biochemical properties, interactions with other cellular components, and its effects on cellular behavior in vitro. Additionally, understanding how PRADC1 functions at a molecular level may lead to the development of therapeutic strategies targeting diseases where it is implicated. This growing interest in PRADC1 emphasizes the need for detailed studies on its structure, function, and potential applications in medicine, making it a significant focus for researchers in the field of molecular biology and biotechnology.
