Analytical Data
-
Gene name
LST1
- Application
-
Alternative Names
LST1;B144;Leukocyte-specific transcript 1 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00453
-
Expression Region
1-66aa
-
AA Sequence
MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT
-
Molecular Weight
11.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LST1 (Leukocyte-specific transcript 1) is a member of the interferon-inducible GTPase family, primarily expressed in immune cells, particularly lymphocytes and macrophages. Its role in the immune response has been of significant interest, especially concerning its involvement in regulating inflammation, cell signaling, and pathogen defense mechanisms. Research has suggested that LST1 may be implicated in various disease processes, including autoimmune disorders and infections. The recombinant expression of LST1 protein allows for a detailed examination of its functional properties, facilitating studies on its structure-function relationship and potential therapeutic applications. Understanding the molecular mechanisms by which LST1 operates could lead to novel insights into the modulation of immune responses and the development of targeted therapies for immune-related diseases. Moreover, the production of LST1 protein in a recombinant form is crucial for biochemical assays, further elucidating its role in immune regulation and providing a platform for drug development and vaccine research. As such, the study of LST1 not only enhances the current knowledge of immune system functioning but also holds promise for advances in clinical applications.











