Analytical Data
-
Gene name
LMO4
- Application
-
Alternative Names
LMO4；LIM domain transcription factor LMO4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61968
-
Expression Region
1-165aa
-
AA Sequence
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
-
Molecular Weight
45.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LMO4 (LIM domain only 4) is a member of the LIM domain protein family, which plays crucial roles in various biological processes, including cell differentiation, neuronal development, and tumorigenesis. The study of LMO4 recombinant protein has gained increasing attention due to its implications in cancer biology, particularly in breast cancer, where LMO4 expression is often upregulated. Understanding the structure and function of LMO4 is pivotal for elucidating its role as a transcriptional co-regulator. Researchers have been focusing on the recombinant production of LMO4 to investigate its interaction with other proteins and its influence on signaling pathways. The recombinant protein allows for detailed functional assays and structural studies, contributing to the knowledge of its molecular mechanisms. Advances in recombinant DNA technology have facilitated the expression and purification of LMO4 in various host systems, providing insights into its potential as a therapeutic target. Moreover, the exploration of LMO4 as a biomarker is essential for developing novel diagnostic and prognostic tools in oncology. Therefore, ongoing research on LMO4 recombinant protein holds promise for uncovering new therapeutic strategies and enhancing our understanding of its role in cancer progression and neuronal functions.
