Analytical Data
-
Gene name
ITPKB
- Application
-
Alternative Names
ITPKB；Inositol-trisphosphate 3-kinase B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27987
-
Expression Region
442-946aa
-
AA Sequence
RVEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSDALPSPELLPQDPDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA
-
Molecular Weight
72.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITPKB (Inositol Trisphosphate Kinase B) is a pivotal protein in cellular signaling pathways, particularly in the regulation of calcium signaling and inositol metabolism. The study of ITPKB has gained significant attention due to its implications in various biological processes, including cell proliferation, differentiation, and apoptosis. Alterations in ITPKB expression and function have been linked to several diseases, including cancer and neurodegenerative disorders, making it a target of interest for therapeutic interventions. The recombinant expression of ITPKB allows for the detailed study of its enzymatic activities and interactions with other cellular proteins. By investigating the structural and functional properties of this protein, researchers aim to elucidate its role in cellular signaling pathways and its potential as a biomarker or therapeutic target. Additionally, understanding the dynamics of ITPKB could provide insights into the complex regulatory networks that govern cell behavior, thereby contributing to the development of novel strategies for disease treatment. The production of recombinant ITPKB has facilitated high-throughput screening and functional assays, paving the way for advancements in drug discovery and the exploration of targeted therapies. Overall, the ongoing research into ITPKB serves as a crucial step in enhancing our understanding of cellular functions and developing innovative medical solutions.
