Analytical Data
-
Gene name
HAPLN4
- Application
-
Alternative Names
HAPLN4；BRAL2；KIAA1926；Hyaluronan and proteoglycan link Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86UW8
-
Expression Region
30-402aa
-
AA Sequence
QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV
-
Molecular Weight
43.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HAPLN4, or Hyaluronan and Proteoglycan Link Protein 4, is a member of the HAPLN family, which plays a crucial role in the organization of the extracellular matrix (ECM) by binding to hyaluronan and proteoglycans. Recent studies have highlighted its significance in various biological processes, including tissue development, maintenance, and repair. The research surrounding HAPLN4 is particularly pertinent in the context of neurological health, as it has been implicated in modulating neural cell interactions and promoting synaptic stability. Aberrant expression or functionality of HAPLN4 has been linked to neurodegenerative diseases, making it a potential biomarker for early diagnosis and therapeutic target. The recombinant production of HAPLN4 enables detailed investigations into its structure-function relationship, facilitating the understanding of its role in cellular environments and its interactions with other ECM components. By exploring the biochemical properties and physiological implications of HAPLN4, researchers aim to elucidate its contribution to ECM dynamics and its potential therapeutic applications in diseases characterized by ECM remodeling and dysfunction. Overall, the study of HAPLN4 and its recombinant protein offers valuable insights into ECM biology, with implications for therapeutic strategies in regenerative medicine and neurology.
