Analytical Data
-
Gene name
HTN3
- Application
-
Alternative Names
HTN3；HSC70；HSP73；HSPA10；Heat shock cognate 71 kDa Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15516
-
Expression Region
20-51aa
-
AA Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDSHAKRHHGYKRKFH EKHHSHRGYRSNYLYDN
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of HTN3 recombinant protein is rooted in its potential significance in understanding cellular functions and disease mechanisms. HTN3, or Histone H3.3 (a variant of histone H3), plays a crucial role in chromatin structure and regulation of gene expression. Unlike its canonical counterpart, HTN3 is incorporated into chromatin during active transcription, suggesting its involvement in epigenetic modifications and cellular differentiation. Research has indicated that alterations in histone variants like HTN3 can lead to various diseases, including cancer, by influencing the accessibility of genomic regions to transcriptional machinery. Furthermore, HTN3's unique incorporation patterns highlight its potential as a biomarker for disease characterization and progression. The recombinant production of HTN3 protein enables researchers to investigate its specific functions, interactions with other proteins, and its role in epigenetic regulation in vitro and in vivo. By elucidating the molecular pathways influenced by HTN3, scientists aim to uncover its contributions to cellular processes and identify potential therapeutic targets. This line of research holds promise for advancing our understanding of epigenetics and improving disease management strategies.
