Analytical Data
-
Gene name
FTSJ1
- Application
-
Alternative Names
FTSJ1；AFT；FTSJD1；Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UET6
-
Expression Region
1-329aa
-
AA Sequence
MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCAAPGSWSQVLSQKIGGQGSGHVVAVDLQAMAPLPGVVQIQGDITQLSTAKEIIQHFKGCPADLVVCDGAPDVTGLHDVDEYMQAQLLLAALNIATHVLKPGGCFVAKIFRGRDVTLLYSQLQVFFSSVLCAKPRSSRNSSIEAFAVCQGYDPPEGFIPDLSKPLLDHSYDPDFNQLDGPTRIIVPFVTCGDLSSYDSDRSYPLDLEGGSEYKYTPPTQPPISPPYQEACTLKRKGQLAKEIRPQDCPISRVDTFPQPLAAPQCHTLLAPEMEDNEMSCSP
-
Molecular Weight
40.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FTSJ1, or FTSJ1 (FtsJ RNA methyltransferase 1), is a member of the FtsJ RNA methyltransferase family, which plays a significant role in the post-transcriptional modification of RNA molecules, particularly in the context of ribosomal RNA (rRNA) and messenger RNA (mRNA) processing. Research has shown that FTSJ1 is involved in various cellular processes, including RNA stability, translation regulation, and ribosome biogenesis, which are crucial for maintaining cellular homeostasis and function. Mutations in the FTSJ1 gene have been associated with X-linked intellectual disability and other neurodevelopmental disorders, highlighting its importance in brain function and development. The understanding of FTSJ1's structure and function is critical for elucidating its role in disease pathology and for potential therapeutic interventions. Recombinant FTSJ1 protein is often produced for detailed biochemical analyses, including studies on its methyltransferase activity, substrate specificity, and interaction with other cellular components. This research not only advances our knowledge of RNA metabolism but also opens avenues for targeting FTSJ1 in disorders linked to its dysfunction, making it a promising candidate for future biomedical investigations.
