Cat: PA1000-4680

Recombinant Human SULT4A1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SULT4A1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SULT4A1;SULTX3;Sulfotransferase 4A1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BR01

  • Expression Region

    1-284aa

  • AA Sequence

    MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWI VTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIK ELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLR TMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMH RDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCSAEALPVGRGRV GLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SULT4A1 (sulfotransferase family 4, member A1) is a member of the sulfotransferase enzyme family that plays a crucial role in the sulfation of various substrates, including neurotransmitters, steroids, and xenobiotics. It is unique among sulfotransferases due to its widespread distribution in the human brain, where it is implicated in modulating the activity of neurotransmitters and potentially influencing cognitive functions and neuropsychiatric disorders. Recent research has highlighted the importance of SULT4A1 in detoxification processes, as it participates in the metabolic inactivation of endogenous and exogenous compounds, thereby contributing to maintaining cellular homeostasis. Additionally, variations in the expression and activity of SULT4A1 have been correlated with susceptibility to neurological diseases, making it a target of interest for studying disease mechanisms and developing therapeutic interventions. Furthermore, the production of recombinant SULT4A1 protein enables detailed biochemical assays, structural studies, and the investigation of its role in sulfation pathways, paving the way for advances in pharmacology and toxicology. Understanding the function and regulation of SULT4A1 is crucial for elucidating its physiological significance and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US