Cat: PA1000-4667

Recombinant Mouse CXCL15 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CXCL15

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CXCL15;Scyb15;C-X-C motif chemokine 15

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9WVL7

  • Expression Region

    26-167aa

  • AA Sequence

    QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

  • Molecular Weight

    23.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CXCL15, also known as Chemokine (C-X-C motif) ligand 15, is a member of the CXC chemokine family primarily involved in immune responses and inflammation. It plays a crucial role in recruiting neutrophils and other immune cells to sites of infection or tissue injury. Elevated levels of CXCL15 have been associated with various pathological conditions, including cancer, where it may contribute to tumor progression and metastasis. The recombinant expression of CXCL15 protein is vital for studying its biological functions, mechanisms of action, and interactions with specific receptors, such as CXCR2. By producing this protein in a recombinant form, researchers can analyze its effects on immune cell migration, signaling pathways, and its potential as a therapeutic target. Furthermore, understanding the role of CXCL15 in immune responses and its involvement in chronic inflammatory diseases and tumor microenvironments can pave the way for developing novel diagnostic and therapeutic strategies. Overall, the investigation of CXCL15 recombinant protein holds significant promise for advancing our knowledge of immune regulation and its implications in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US