Analytical Data
-
Gene name
CXCL15
- Application
-
Alternative Names
CXCL15;Scyb15;C-X-C motif chemokine 15
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9WVL7
-
Expression Region
26-167aa
-
AA Sequence
QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA
-
Molecular Weight
23.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCL15, also known as Chemokine (C-X-C motif) ligand 15, is a member of the CXC chemokine family primarily involved in immune responses and inflammation. It plays a crucial role in recruiting neutrophils and other immune cells to sites of infection or tissue injury. Elevated levels of CXCL15 have been associated with various pathological conditions, including cancer, where it may contribute to tumor progression and metastasis. The recombinant expression of CXCL15 protein is vital for studying its biological functions, mechanisms of action, and interactions with specific receptors, such as CXCR2. By producing this protein in a recombinant form, researchers can analyze its effects on immune cell migration, signaling pathways, and its potential as a therapeutic target. Furthermore, understanding the role of CXCL15 in immune responses and its involvement in chronic inflammatory diseases and tumor microenvironments can pave the way for developing novel diagnostic and therapeutic strategies. Overall, the investigation of CXCL15 recombinant protein holds significant promise for advancing our knowledge of immune regulation and its implications in various diseases.











