Cat: PA2000-1968

Recombinant Human DTWD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DTWD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DTWD1;tRNA-uridine aminocarboxypropyltransferase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N5C7

  • Expression Region

    1-109aa

  • AA Sequence

    MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI

  • Molecular Weight

    39.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DTWD1 (Dihydroorotate Dehydrogenase 1) is an enzyme that plays a crucial role in the de novo pyrimidine biosynthesis pathway, responsible for the conversion of dihydroorotate to orotate, a key precursor for nucleotide synthesis. Understanding the structure and function of DTWD1 is critical due to its implications in various biological processes, including cell proliferation and differentiation. Dysregulation of pyrimidine metabolism has been linked to several diseases, including cancer and autoimmune disorders. As a result, DTWD1 is emerging as a potential therapeutic target for developing innovative treatments. The reconstitution of DTWD1 as a recombinant protein provides an essential tool for detailed biochemical studies, allowing researchers to analyze its enzymatic activity, substrate specificity, and inhibition by potential drug candidates. Furthermore, studying the protein's structure through techniques like X-ray crystallography or NMR can reveal insights into the molecular mechanisms underlying its function and interactions with other biomolecules. This research not only enhances our understanding of DTWD1's biological role but also paves the way for exploring its potential as a drug target, ultimately contributing to the development of novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US