Analytical Data
-
Gene name
DTWD1
- Application
-
Alternative Names
DTWD1；tRNA-uridine aminocarboxypropyltransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N5C7
-
Expression Region
1-109aa
-
AA Sequence
MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI
-
Molecular Weight
39.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DTWD1 (Dihydroorotate Dehydrogenase 1) is an enzyme that plays a crucial role in the de novo pyrimidine biosynthesis pathway, responsible for the conversion of dihydroorotate to orotate, a key precursor for nucleotide synthesis. Understanding the structure and function of DTWD1 is critical due to its implications in various biological processes, including cell proliferation and differentiation. Dysregulation of pyrimidine metabolism has been linked to several diseases, including cancer and autoimmune disorders. As a result, DTWD1 is emerging as a potential therapeutic target for developing innovative treatments. The reconstitution of DTWD1 as a recombinant protein provides an essential tool for detailed biochemical studies, allowing researchers to analyze its enzymatic activity, substrate specificity, and inhibition by potential drug candidates. Furthermore, studying the protein's structure through techniques like X-ray crystallography or NMR can reveal insights into the molecular mechanisms underlying its function and interactions with other biomolecules. This research not only enhances our understanding of DTWD1's biological role but also paves the way for exploring its potential as a drug target, ultimately contributing to the development of novel therapeutic strategies.
