Analytical Data
-
Gene name
DCTN3
- Application
-
Alternative Names
DCTN3；DCTN22；Dynactin subunit 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75935
-
Expression Region
2-176aa
-
AA Sequence
AGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH
-
Molecular Weight
35.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCTN3, or dynactin subunit 3, is a crucial component of the dynactin complex, which plays an essential role in cellular transport processes, particularly in the transport of organelles and vesicles along microtubules. Recent studies have indicated that DCTN3 is involved in various cellular functions, including cell division, intracellular signaling, and the maintenance of cellular homeostasis. Its significance is underscored by its association with neurodegenerative diseases, as mutations or dysregulation of DCTN3 can lead to impairments in cellular transport mechanisms, contributing to the pathogenesis of conditions such as amyotrophic lateral sclerosis (ALS) and other motor neuron diseases. Research into DCTN3 recombinant proteins has gained traction due to the need to better understand its structure-function relationships and interactions with other proteins in the dynactin complex. By generating and characterizing recombinant DCTN3, scientists aim to elucidate its biochemical properties, interactions, and role in cellular processes. Such studies are vital for developing potential therapeutic strategies to mitigate diseases linked to dynactin dysfunction. The ongoing investigation not only enhances our understanding of basic cellular mechanisms but also paves the way for targeted interventions in related pathologies, emphasizing the importance of DCTN3 in both fundamental biology and clinical research.
