Analytical Data
-
Gene name
RNASE6
- Application
-
Alternative Names
RNASE6；RNS6；Ribonuclease K6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q93091
-
Expression Region
24-150aa
-
AA Sequence
WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL
-
Molecular Weight
19.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNASE6, a member of the ribonuclease A superfamily, is an endonuclease known for its potential roles in various biological processes, including innate immunity and inflammation. The protein has garnered attention due to its involvement in RNA processing and its capacity to degrade double-stranded RNA, which is crucial for defending against viral infections. Increased expression of RNASE6 has been observed in various inflammatory conditions, suggesting it may serve as a biomarker for disease and a target for therapeutic intervention. Additionally, studies have indicated that RNASE6 might modulate immune responses by influencing macrophage activity and cytokine production. Given its multifaceted roles, the recombination and characterization of RNASE6 protein are essential for understanding its structure-function relationship and therapeutic potential. The exploration of RNASE6 in recombinant form allows for detailed biochemical assays, structural studies, and functional assays, which can elucidate its mechanisms of action in immune responses and disease pathology. Moreover, recombinant RNASE6 could facilitate the development of novel therapeutic strategies for diseases driven by dysregulated inflammation or viral infections, making it a significant focus of current biomedical research.
