Analytical Data
-
Gene name
CFDP1
- Application
-
Alternative Names
CFDP1；BCNT；CENP-29；Craniofacial development Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UEE9
-
Expression Region
1-299aa
-
AA Sequence
MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP
-
Molecular Weight
60.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CFDP1, or "CFC domain containing protein 1," is a critical protein implicated in various cellular processes, including gene regulation and response to stress. Recent research has suggested its involvement in the regulation of epithelial-mesenchymal transition (EMT), a vital process in embryogenesis and cancer metastasis. Understanding CFDP1's function is essential as it may play a role in the progression of various diseases, particularly cancer. The protein's structure contains key domains that suggest potential interactions with other molecular partners, highlighting its importance in cellular signaling pathways. Additionally, studies have indicated that aberrant expression of CFDP1 is associated with several pathological conditions, making it a candidate for therapeutic targeting. As research advances, the recombinant expression of CFDP1 has become a focal point for understanding its biochemical properties and interactions, which could lead to novel insights into its role in health and disease. By producing CFDP1 in a laboratory setting, scientists can investigate its functional mechanisms more thoroughly, potentially paving the way for innovative treatments that harness or manipulate its activity in various disease contexts. Overall, CFDP1 stands as a promising target for further investigation, with the potential to unlock new therapeutic avenues in the management of diseases where its dysregulation plays a critical role.
