Cat: PA1000-4393

Recombinant Human SPINK4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SPINK4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SPINK4;SGT2;Small glutamine-rich tetratricopeptide repeat-containing Protein beta

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60575

  • Expression Region

    27-86aa

  • AA Sequence

    GKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQ DIQIMKDGKCVDHHHHHH

  • Molecular Weight

    8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SPINK4, or Serine Peptidase Inhibitor, Kazal Type 4, is a member of the serine protease inhibitor family. It plays a crucial role in various physiological processes, including innate immunity and tissue homeostasis. Research has indicated that SPINK4 is involved in the regulation of serine proteases, which are enzymes that can contribute to inflammation and tissue remodeling when uncontrolled. Dysregulation of SPINK4 has been implicated in several pathological conditions, including skin disorders like atopic dermatitis and autoimmune diseases. Given its important protective functions, understanding the molecular mechanisms underlying SPINK4's activity can facilitate the development of therapeutic strategies against disorders involving serine proteases. The generation of recombinant SPINK4 protein provides a valuable tool for studying its biological functions and interactions at a molecular level. By employing techniques such as gene cloning and expression in suitable systems (such as bacteria or mammalian cells), researchers can produce large quantities of SPINK4 for functional assays, inhibition studies, and structural analyses. This research not only deepens our understanding of protease regulation but also holds potential for advancing therapeutic interventions that target SPINK4 in disease contexts. Overall, the investigation of SPINK4 in both health and disease represents a compelling area of study that bridges basic biomedical research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US