Analytical Data
-
Gene name
SPINK4
- Application
-
Alternative Names
SPINK4；SGT2；Small glutamine-rich tetratricopeptide repeat-containing Protein beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60575
-
Expression Region
27-86aa
-
AA Sequence
GKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQ DIQIMKDGKCVDHHHHHH
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPINK4, or Serine Peptidase Inhibitor, Kazal Type 4, is a member of the serine protease inhibitor family. It plays a crucial role in various physiological processes, including innate immunity and tissue homeostasis. Research has indicated that SPINK4 is involved in the regulation of serine proteases, which are enzymes that can contribute to inflammation and tissue remodeling when uncontrolled. Dysregulation of SPINK4 has been implicated in several pathological conditions, including skin disorders like atopic dermatitis and autoimmune diseases. Given its important protective functions, understanding the molecular mechanisms underlying SPINK4's activity can facilitate the development of therapeutic strategies against disorders involving serine proteases. The generation of recombinant SPINK4 protein provides a valuable tool for studying its biological functions and interactions at a molecular level. By employing techniques such as gene cloning and expression in suitable systems (such as bacteria or mammalian cells), researchers can produce large quantities of SPINK4 for functional assays, inhibition studies, and structural analyses. This research not only deepens our understanding of protease regulation but also holds potential for advancing therapeutic interventions that target SPINK4 in disease contexts. Overall, the investigation of SPINK4 in both health and disease represents a compelling area of study that bridges basic biomedical research and clinical applications.
