Analytical Data
-
Gene name
PRKCABP
- Application
-
Alternative Names
dJ1039K5; MGC15204; OTTHUMP00000028509; PICK 1; Pick1; PICK1_HUMAN; PRKCA binding protein; PRKCA-binding protein; PRKCABP; Protein interacting with C kinase 1; Protein interacting with PRKCA; Protein interacting with PRKCA 1; Protein kinase C alpha binding protein; Protein kinase C-alpha-binding protein; Protein that interacts with C kinase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRD5
-
Expression Region
1-200 aa
-
AA Sequence
MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQ
-
Molecular Weight
48.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRKCABP, or Protein Kinase C Alpha binding protein, is a crucial adaptor protein involved in various cellular signaling pathways, particularly those related to cell proliferation, differentiation, and survival. Its role in mediating the effects of specific growth factors and hormones has garnered substantial interest among researchers. Abnormalities in PRKCABP expression or function have been associated with several diseases, including cancer and cardiovascular disorders. Recent studies have emphasized the importance of PRKCABP in cancer cell survival, highlighting its potential as a therapeutic target. Recombining PRKCABP allows for a deeper exploration of its functional motifs and the pathways it influences, providing insights into its mechanistic roles. Moreover, generating recombinant PRKCABP enables scientists to produce sufficient quantities of the protein for structural and functional studies, paving the way for drug design and the development of targeted therapies. Understanding the precise mechanisms by which PRKCABP interacts with other signaling molecules is key to unraveling its contributions to disease processes and identifying novel intervention strategies. Thus, research into recombinant PRKCABP not only advances our knowledge of cellular signaling but also holds promise for impactful clinical applications in treating diseases linked to its dysregulation.
