Cat: PA2000-1910

Recombinant Human COA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    COA1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    COA1;C7orf44;MITRAC15;Cytochrome c oxidase assembly factor 1 homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9GZY4

  • Expression Region

    38-146aa

  • AA Sequence

    QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE

  • Molecular Weight

    39.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

COA1, or cofactor of ARNT1, is a protein that plays a crucial role in various biological processes, particularly in cellular metabolism and signal transduction. As a cofactor, COA1 acts as a regulatory protein associated with the hypoxia-inducible factor (HIF) signaling pathway, which is vital for cellular responses to oxygen levels and metabolic changes. Recent studies have indicated that COA1 is implicated in several pathophysiological conditions, including cancer and metabolic disorders, where it may influence tumor growth and cellular adaptation to hypoxic environments. The recombinant production of COA1 protein has become a focus of research, enabling scientists to investigate its structure-function relationships in detail. By utilizing techniques such as molecular cloning and protein expression systems, researchers aim to produce functional COA1 protein for biochemical assays, structural studies, and potential therapeutic applications. Understanding the role of COA1 at the molecular level may provide insights into its involvement in disease processes, paving the way for novel intervention strategies that target HIF-mediated pathways in various health conditions. Thus, COA1 recombinant protein studies are critical not only for elucidating fundamental biological mechanisms but also for the development of new therapeutic approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US