Analytical Data
-
Gene name
COA1
- Application
-
Alternative Names
COA1；C7orf44；MITRAC15；Cytochrome c oxidase assembly factor 1 homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZY4
-
Expression Region
38-146aa
-
AA Sequence
QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
-
Molecular Weight
39.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COA1, or cofactor of ARNT1, is a protein that plays a crucial role in various biological processes, particularly in cellular metabolism and signal transduction. As a cofactor, COA1 acts as a regulatory protein associated with the hypoxia-inducible factor (HIF) signaling pathway, which is vital for cellular responses to oxygen levels and metabolic changes. Recent studies have indicated that COA1 is implicated in several pathophysiological conditions, including cancer and metabolic disorders, where it may influence tumor growth and cellular adaptation to hypoxic environments. The recombinant production of COA1 protein has become a focus of research, enabling scientists to investigate its structure-function relationships in detail. By utilizing techniques such as molecular cloning and protein expression systems, researchers aim to produce functional COA1 protein for biochemical assays, structural studies, and potential therapeutic applications. Understanding the role of COA1 at the molecular level may provide insights into its involvement in disease processes, paving the way for novel intervention strategies that target HIF-mediated pathways in various health conditions. Thus, COA1 recombinant protein studies are critical not only for elucidating fundamental biological mechanisms but also for the development of new therapeutic approaches.
