Analytical Data
-
Gene name
PERP
- Application
-
Alternative Names
PERP；KCP1；KRTCAP1；PIGPC1；p53 apoptosis effector related to PMP-22
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FX8
-
Expression Region
1-193aa
-
AA Sequence
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWK CSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALC GPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYN WAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PERP (p53 apoptosis effector related to PMP-22) is a member of the tetraspanin family and has garnered significant attention in cancer research due to its role in mediating cellular responses influenced by the tumor suppressor protein p53. Initially identified as a gene that responds to p53 activation, PERP is implicated in processes such as apoptosis, cell adhesion, and tissue differentiation. Studies have shown that PERP expression is often downregulated in various types of tumors, suggesting a potential role as a tumor suppressor. Its involvement in the p53 pathway highlights the importance of preserving its function for maintaining genomic stability and preventing tumorigenesis. Moreover, PERP has also been linked to the regulation of cellular senescence, thus providing insights into its role in aging and age-related diseases. As researchers continue to elucidate the molecular mechanisms underlying PERP function, therapeutic strategies aimed at restoring its activity in tumor cells are being explored. This could offer new avenues for cancer treatment, particularly in cases where p53 is functional but its downstream effectors, like PERP, are lost or impaired. Overall, the ongoing exploration of PERP, including its structure, regulatory mechanisms, and interactions with other proteins, aims to deepen our understanding of its critical functions in both normal physiology and disease.
