Cat: PA1000-4232

Recombinant Human STMN1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STMN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STMN1;C1orf215;Stathmin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P16949

  • Expression Region

    2-149aa

  • AA Sequence

    ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQ KKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKL THKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

STMN1 (stathmin-1) is a protein that plays a crucial role in regulating microtubule dynamics, impacting cell division, signal transduction, and cellular proliferation. Its dysregulation is associated with various cancers and neurodegenerative diseases, making it a target of interest for therapeutic interventions. The study of recombinant STMN1 has gained prominence due to advancements in recombinant DNA technology, enabling the production of this protein in vitro for detailed biochemical and structural analyses. Understanding the precise mechanisms by which STMN1 influences microtubule stability and cellular behavior can provide insights into its functions in normal physiology and disease states. Researchers are focused on elucidating the structural characteristics of STMN1 and its interactions with microtubules, which could reveal novel targets for drug development and therapeutic strategies. Additionally, recombinant STMN1 serves as a valuable tool in developing assays to screen for small molecules that can modulate its activity, potentially leading to innovative treatments for cancers where STMN1 is overexpressed or misregulated. Overall, the investigation of STMN1 recombinant protein is crucial for advancing our understanding of microtubule dynamics and its implications in disease, thereby paving the way for the development of targeted therapies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US