Analytical Data
-
Gene name
STMN1
- Application
-
Alternative Names
STMN1；C1orf215；Stathmin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16949
-
Expression Region
2-149aa
-
AA Sequence
ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQ KKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKL THKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STMN1 (stathmin-1) is a protein that plays a crucial role in regulating microtubule dynamics, impacting cell division, signal transduction, and cellular proliferation. Its dysregulation is associated with various cancers and neurodegenerative diseases, making it a target of interest for therapeutic interventions. The study of recombinant STMN1 has gained prominence due to advancements in recombinant DNA technology, enabling the production of this protein in vitro for detailed biochemical and structural analyses. Understanding the precise mechanisms by which STMN1 influences microtubule stability and cellular behavior can provide insights into its functions in normal physiology and disease states. Researchers are focused on elucidating the structural characteristics of STMN1 and its interactions with microtubules, which could reveal novel targets for drug development and therapeutic strategies. Additionally, recombinant STMN1 serves as a valuable tool in developing assays to screen for small molecules that can modulate its activity, potentially leading to innovative treatments for cancers where STMN1 is overexpressed or misregulated. Overall, the investigation of STMN1 recombinant protein is crucial for advancing our understanding of microtubule dynamics and its implications in disease, thereby paving the way for the development of targeted therapies.
