Analytical Data
-
Gene name
VACWR074
- Application
-
Alternative Names
VACWR074；Protein OPG081
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12924
-
Expression Region
2-79aa
-
AA Sequence
VDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS
-
Molecular Weight
8.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VACWR074 is a recombinant protein derived from the variola virus, which is responsible for smallpox. The study of VACWR074 is significant due to the historical impact of smallpox on global health and its eradication in 1980, leading to an increased focus on potential bioterrorism threats and the development of vaccines and antiviral strategies against orthopoxviruses. Researchers aim to elucidate the molecular mechanisms by which VACWR074 interacts with host immune responses, particularly its role in modulating the innate and adaptive immune systems. This protein may function as a viral immunomodulator, influencing cytokine production and immune cell activation, which could provide insights into viral pathogenesis and immune evasion strategies. Additionally, understanding VACWR074's functions could lead to novel therapeutic interventions or vaccine strategies against orthopoxvirus infections, especially in the context of emerging zoonotic orthopoxviruses. The exploration of this protein also contributes to broader studies in virology, immunology, and the development of recombinant technologies for vaccine production. Overall, VACWR074 serves as an important target for research aimed at enhancing preparedness for potential smallpox re-emergence or outbreaks of related orthopoxviruses, thereby ensuring public health safety.
