Cat: PA1000-4114

Recombinant Human ESAM Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ESAM

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ESAM;Endothelial cell-selective adhesion molecule

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96AP7

  • Expression Region

    30-247aa

  • AA Sequence

    QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKE KEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVN VQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRS KPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNE VGTAQCNVTLEVSTGPGAVDHHHHHH

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ESAM (Endothelial/Platelet Adhesion Molecule) is a member of the immunoglobulin superfamily and plays a crucial role in regulating cellular adhesion and signaling processes in the vascular system. Its expression is primarily found in endothelial cells and platelets, where it is involved in maintaining vascular homeostasis and mediating leukocyte adhesion during inflammatory responses. Research has shown that ESAM contributes to various physiological and pathological conditions, including angiogenesis, thrombosis, and inflammatory diseases. Given its significant role in cell adhesion and interaction with the immune system, ESAM has emerged as a potential therapeutic target for treating vascular-related disorders. Recent developments in recombinant protein technology have enabled researchers to produce ESAM in a controlled and scalable manner, facilitating detailed studies on its structure-function relationships. Understanding the molecular mechanisms of ESAM’s action can provide insights into its role in cardiovascular health and disease. Overall, the investigation of ESAM recombinant proteins offers a promising avenue for developing novel therapeutic strategies that target endothelial and platelet functions, ultimately aiming to enhance vascular health and combat vascular diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US