Analytical Data
-
Gene name
C10orf78
- Application
-
Alternative Names
SFR1; C10orf78; MEI5; MEIR5; Swi5-dependent recombination DNA repair Protein 1 homolog; Meiosis Protein 5 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86XK3
-
Expression Region
1-245aa
-
AA Sequence
MAEGEKNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQPMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSKNDLSQLQLLIKKWRSCSQLLLYELQSAVSEENKKLSLTQLIDHYGLDDKLLHYNRSEEEFIDV
-
Molecular Weight
54.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C10orf78, also known as "Chromosome 10 open reading frame 78," has garnered attention in recent years due to its potential role in various biological processes and its implications in human diseases. Initially identified through genomic studies, C10orf78 encodes a protein whose precise function remains largely uncharacterized. However, emerging evidence suggests that it may be involved in cellular functions such as cell cycle regulation, apoptosis, and stress responses. The study of C10orf78 is particularly relevant in the context of cancer research, as its expression has been linked to the progression and treatment response of certain tumors. Additionally, variations in the C10orf78 gene have been associated with neurodegenerative diseases, highlighting its potential importance in neuronal health. To further understand this protein, researchers are now focusing on the recombinant expression of C10orf78. This approach allows for the production of large quantities of the protein for biochemical and functional analyses, facilitating the elucidation of its biological roles and mechanisms of action. Ultimately, a deeper understanding of C10orf78 could lead to novel therapeutic strategies for diseases where its dysregulation is implicated. Thus, the study of C10orf78 and its recombinant protein form represents a promising frontier in molecular biology and medical research, with the potential to uncover new insights into fundamental cellular processes and disease mechanisms.
